+33 (0) 4 76 45 21 20 contact@smart-bioscience.com

Peptide synthesis services

RANTES/CCL5 – Chemokine against viral infections

RANTES (or Regulated upon Activation, Normal T-cell Expressed and Secreted), also known as CCL5 (Chemokine (CC chemokine ligand 5), is a protein classified as a chemotactic cytokine or chemokine.
Chemokines are small soluble proteins that act as molecular signals to induce cellular migration during inflammation.
RANTES is a member of the CC chemokine family and is involved in immunoregulatory and inflammatory processes.
RANTES is expressed in a lot of immune cells and acts as a potent chemoattractant for T-cells, basophils, eosinophils, monocytes and other cell types by playing a major role in recruiting leukocytes into inflammatory sites and to activate them. RANTES also induces proliferation and activation of certain natural killer cells.
RANTES synthesis is induced by TNF-alpha and IL-1 alpha, interacts with CCR3, CCR1 and CCR5 and activates some G-protein coupled receptors.
Many of the biological activities of RANTES (Ca2+ influx, chemotactic response, basophil activation, T-cell signaling) are observed between 40 and 8000 ng/mL.

Technical specification

AA sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Disulfide bonds: Cys10-Cys24, Cys11-Cys50
Length (aa): 68
Formula: C350H534N96O100S5
Molecular Weight: 7847.07 g/mol
CAS number: 1927910-48-2
Source: Synthetic
Purity rate: > 95 %
Preparation and storage : Lyophilized powder, trifluoroacetate (TFA) salt format. Shipped at ambient temperature. Upon receipt, store lyophilized peptide at -20°C or lower. Reconstituted peptide can be aliquoted and stored at -20°C or lower. Avoid repeated freeze/thaw cycles.

Price

Product catalogSizePrice € HTPrice $ USD
SB006-001MG0.01 mg100118
SB006-01MG0.1 mg500591