+33 (0) 4 76 45 21 20 contact@smart-bioscience.com

Peptide synthesis services

Scrambled LL-37 peptide – Potent antimicrobial peptide

Scrambled LL-37 has the same peptide sequence as LL-37 peptide but has lost its helixforming property.
Scrambled LL-37 can be used as a negative control of LL-37 studies.
(See section « LL-37 » )

Technical specification

AA sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Disulfide bonds: 0
Length (aa): 37
Formula: C205H340N60O53
Molecular Weight: 4493.40 g/mol
CAS number: N/A
Source: Synthetic
Purity rate: > 95 %
Preparation and storage : Lyophilized powder, trifluoroacetate (TFA) salt format. Shipped at ambient temperature. Upon receipt, store lyophilized peptide at -20°C or lower. Reconstituted peptide can be aliquoted and stored at -20°C or lower. Avoid repeated freeze/thaw cycles.

 

Price

Product catalogSizePrice € HTPrice $ USD
SB010-1MG1 mg115134
SB010-5*1MG5x1 mg400469