+33 (0) 4 76 45 21 20 contact@smart-bioscience.com

Peptide synthesis services

LL-37 – Human cathelicidin peptide – Potent antimicrobial peptide

LL-37, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide. LL-37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. LL-37 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes.
LL-37 plays an important role in the first act of defense against local infection and systemic invasion of pathogens at sites of inflammation.
LL-37 shows cytotoxicity against bacterial and normal eukaryotic cells and is significantly resistant to proteolytic degradation. Besides its antimicrobial functions, LL-37 also has immunomodulatory roles. LL-37 suppresses the production of pro-inflammatory cytokines, TNF-α and IL-6 in infected monocytes. LL-37 increases cytokine and chemokine liberation from local cells and leucocytes and has chemotactic effects on a large number of immune cells.

Technical specification

AA sequence: [LL-37, 37 aa]
Disulfide bonds: 0
Length (aa): 37
Formula: C205H340N60O53
Molecular Weight: 4493.40 g/mol
CAS number: 154947-66-7
Source: Synthetic
Purity rate: > 95 %
Preparation and storage : Lyophilized powder, trifluoroacetate (TFA) salt format. Shipped at ambient temperature. Upon receipt, store lyophilized peptide at -20°C or lower. Reconstituted peptide can be aliquoted and stored at -20°C or lower. Avoid repeated freeze/thaw cycles.

Price

Product catalogSizePrice € HTPrice $ USD
SB004-1MG1 mg115134
SB004-5*1MG5x1 mg400469