+33 (0) 4 76 45 21 20 contact@smart-bioscience.com

Peptide synthesis services

hBD-2 peptide – Antimicrobial peptide and Kv1.3 channel blocker

Human beta-defensin-2 (hBD-2) peptide, also known as skin-antimicrobial peptide 1 (SAP1) is a cysteine-rich cationic antimicrobial peptide of 41 amino acids. It was originally isolated from skin cells of psoriasis patients. hBD-2 peptide, which belongs to the defensin family, is implicated in the innate immunity thanks to its antimicrobial activity. Thus, β-defensins can play a role at the cutaneous level by limiting the use of antibiotics in severe burns and disease like psoriasis. Moreover, at the pulmonary level, defensins might be involved in the resorption of the infection in cases of cystic fibrosis.
hBD-2 peptide is produced after stimulation of epithelial cells following their contact with some organisms like Gram-negative bacteria and Candida Albicans, fungus or cytokines such as TNF-alpha and IL-1 beta. This antimicrobial activity was shown to be microbicidal at concentrations greater than 1 µM and was lethal for E.Coli and pseudomonas (LD90 : 10 mg/mL) and Candida Albicans (LD90 : 25 mg/mL). Besides its antimicrobial activity, hBD-2 also exhibits proinflammatory properties as chemoattractants for memory T-cells, immature dendritic cells, mast cells and neutrophils.
hBD-2 peptide has also demonstrated inhibitory activity of the voltage-gated potassium channel Kv1.3 at picomolar concentration. Kv1.3 are overexpressed by T-cells in case of autoimmune disorders

Technical specifications

AA sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Disulfide bonds: Cys8-Cys37, Cys15-Cys30, Cys20-Cys38
Length (aa): 41
Formula:  C188H305N55O50S6
Molecular Weight: 4328.22 g/mol
CAS: N/A
Source: synthetic
Purity rate: > 95%
Preparation and storage: Lyophilized powder, trifluoroacetate (TFA) salt format. Shipped at ambient temperature. Upon receipt, store lyophilized peptide at -20°C or lower. Reconstituted peptide can be aliquoted and stored at -20°C or lower. Avoid repeated freeze/thaw cycles.

Price

Catalog codeSizePrice €Price $ USD
SB002-01MG0.1 mg250312
SB002-05MG0.5 mg8751095
SB002-1MG1 mg13751715