+33 (0) 4 76 45 21 20 contact@smart-bioscience.com

Peptide synthesis services

Abaecin – Antimicrobial peptide

Abaecin is a proline-rich cationic antimicrobial peptide (PrAMP) and was isolated from Apis mellifera. Abaecin is a 34 amino acid peptide including 10 prolines positioned uniformly which prevents the α-helical conformation.

Technical specifications

AA sequence: YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY-OH
Disulfide bonds: 0
Length (aa): 34 Formula : C187H270N48OS43
Molecular weight: 3878.54 g/mol
CAS number: N/A
Source: Synthetic
Purity rate: > 95 %
Preparation and storage: Lyophilized powder, trifluoroacetate (TFA) salt format. Shipped at ambient temperature. Upon receipt, store lyophilized peptide at -20°C or lower. Reconstituted peptide can be aliquoted and stored at -20°C or lower. Avoid repeated freeze/thaw cycles.

 

Prices

Product catalogSizePrice € HTPrice $ USD
SB025-1MG1 mg115134
SB025-5*1MG5x1 mg400469